PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0119700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 335aa    MW: 36244 Da    PI: 9.555
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0119700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.1e-3967126261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++++l+cprCdstntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvP+Ggg+rk k+s
  Spipo2G0119700  67 EQQNLRCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTQGGALRNVPIGGGCRKTKTS 126
                     57899***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2667124IPR003851Zinc finger, Dof-type
PfamPF027017.4E-3369125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.41371125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVCIVLGLEN ISVRRKEEGK MIQELLGGAA DDRKVCVSGG LLGAAVDPPL PNPSSSSASP  60
SSTTNSEQQN LRCPRCDSTN TKFCYYNNYN LTQPRHFCKT CRRYWTQGGA LRNVPIGGGC  120
RKTKTSGITV GPGKSSGGGA TKVRPLAGFS VGVGSPTGFN HELHSNTILW AEPLNSQLLA  180
LLRATTQSSS VSNSNTNSIP IPNPNPTPAT SISPFRIKED DPAVASNLVP DASLLINALN  240
SRSLGIDPFG LRSSLWKLQQ QQQEPQQEQN NGFLFSEPPT SGIHELLQKL RSQGNYWTDH  300
PGMAPGNVFV FPLWARRFIL SCDGVIELRS WKRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1867485e-48AC186748.1 Musa acuminata clone MA4_8L21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039230.17e-71PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
RefseqXP_011039231.13e-71PREDICTED: dof zinc finger protein DOF1.1-like isoform X2
TrEMBLA9P9B56e-70A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.12e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.17e-34Dof family protein